DPCstruct | MC1989
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 159 ± 14 aa |
| Standard deviation of domain lengths | 13.72 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16702 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F3IW23 | 3-168 | EENIQHTSVQELMAVANEYCWLLENISGFEPDKVLEFLRKIMPLLYIKGCMISAPEGAEEGDMQRYVTEENYEIIFNDVRNKLKKFE… |
| A0A2T5YXR5 | 16-177 | GRPNTYGFLSAARAFVALLESNAIDKNVFFKESHTKLLGLYFAAFKLDTVELKYSSAETTFESIFVSKNVGMIAELGKDEYYWETSE… |
| A0A838KFH0 | 10-176 | None |
| A0A2D9C498 | 104-278 | None |
| A0A1V6HZ21 | 3-165 | None |
| A0A1V5W0X9 | 3-162 | None |
| A0A7Y5PVJ8 | 3-165 | None |
| A0A7X7LGQ1 | 30-204 | None |
| A0A661MGY7 | 580-736 | None |
| A0A2X4SSX0 | 108-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.