DPCstruct | MC19889
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 159 ± 30 aa |
| Standard deviation of domain lengths | 30.33 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 90.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10973 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H4GR47 | 1-155 | MSPEECAVADWERIGEMDARAGQGMSYFARRADDCAEAGYPADREAWTHGWDTGIVWFCTRNNGFRQGINGQRYDSICPGELEPEFL… |
| D0WZM8 | 1-128 | MSPDECKTANWYNVGYQDGRDGNDPSIINSYTEDCGEAGVIPDRAKWKEGFDKGTIQYCSPDNGYTVGIEGKEYYGVCSSKEFIENY… |
| A0A317J924 | 50-190 | None |
| A0A1V4XBR5 | 13-169 | None |
| A0A7Y2CFF5 | 11-180 | None |
| A0A2E5CCF4 | 5-131 | None |
| M4VBY0 | 8-243 | None |
| A0A511QCM2 | 7-174 | None |
| A0A2G9CBA4 | 68-284 | None |
| A0A1Z7Z4A2 | 2-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.