DPCstruct | MC19887
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 85 ± 12 aa |
| Standard deviation of domain lengths | 11.92 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1KST6 | 39-127 | FTFKSATIHILSSANLPLTSREIYTHIKNNKMVMTVGKTPQNTIASLMYTDMNKKGSESLFVRFGADPIRFGLRNLLERYRRNYKAL… |
| A0A6N8VIS9 | 7-83 | TDMPPTALEAAYEVLNEAEEPLHYEEVTRRMLERGLWQTRGKTPWATVNARIAVDIKELGQESRFLRVGRGIFTVGI |
| A0A7S0WC84 | 169-246 | None |
| A0A4Q3JVY9 | 14-91 | None |
| A0A7X7XGH7 | 1-87 | None |
| A0A6P8H9T1 | 1-89 | None |
| A0A061R3L8 | 126-200 | None |
| A0A0F9UDB6 | 96-180 | None |
| A0A517YF41 | 73-158 | None |
| A0A1V5NBR7 | 2-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.