DPCstruct | MC19886
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 112 ± 10 aa |
| Standard deviation of domain lengths | 9.77 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N8VHE0 | 851-968 | SCRADAETLCLQNSRFQVKVGWWNADGESGVGWVVEDRTDDSGMFRFFGPLNWEILIKVLDGCRSNRRMWVLAAATTDLGYRIVVTD… |
| A0A7X3TXD4 | 16-122 | PTVAPLTLEGGVKVSLCYQAPNGAMDDASAVYRSDNSGLLYFFEPDNAEVFVKVLDGCGINQHRWVYVAPLTDVAFNMYINDGRNPT… |
| A0A6N8XWN4 | 2-110 | None |
| A0A6N8Y0P5 | 18-138 | None |
| A0A7T9CKI5 | 307-419 | None |
| A0A7T9HKB5 | 841-965 | None |
| A0A845BTA3 | 20-126 | None |
| A0A6A0ILE4 | 106-220 | None |
| A0A3E0NVN0 | 306-434 | None |
| A0A3E0NWE0 | 242-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.