DPCstruct | MC19885
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 68 ± 6 aa |
| Standard deviation of domain lengths | 6.36 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 30.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A395JTS0 | 320-387 | SAPQESYAEYKCITIGMKMKQIQSIQGNPSTVHNHTNEIVWRYGVSTVVFVEGVVTEWSDKGNNLKLT |
| A0A2W6ZV56 | 157-229 | SASQNRWTLGATETDVLQLQGTPTRQEQYTSNGFTTLYYGKSSVMFENGQVIGYLNADQNLKVSVQPPALLSG |
| A0A839R6T1 | 121-181 | None |
| A0A1G1JY86 | 192-246 | None |
| A0A7C1KXU7 | 267-342 | None |
| A0A562JWI6 | 207-278 | None |
| A0A5D4SAN0 | 207-275 | None |
| A0A6I5PCF0 | 149-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.