DPCstruct | MC19881
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 91 ± 14 aa |
| Standard deviation of domain lengths | 14.29 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 52.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U5N6M5 | 70-152 | QQIMTFLNEPWSGNLLKHEEFIGSEVQLHPLEFSTSQVKNALNDKALNHWKGCFAPEILSRMDDLAPMLKQLGYNTSTETPFY |
| A0A0K0F0F9 | 4-93 | AWNEIVLNHEQFIGTKVLVSKLERSSDQVIKPINIDALAKWMGNIPKDDLENMENIAPMLQFLGYDLFANPPNCGIPDEEVINKSDN… |
| A0A091DLA9 | 227-308 | None |
| A0A6H5GDS4 | 183-253 | None |
| A0A4S2L9U7 | 48-151 | None |
| A0A7R8CMR4 | 596-676 | None |
| A0A0B2VZT2 | 136-231 | None |
| A0A7I8VVL3 | 954-1064 | None |
| A0A498NBA8 | 7-110 | None |
| A0A2D4G288 | 11-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.