DPCstruct | MC1988
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 471 ± 64 aa |
| Standard deviation of domain lengths | 63.67 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N0WDP6 | 19-537 | FSALVSSGNNAWSASENRKSSESISRLNRDSSEEIARLSRKHSAELQYNQLKFSVLQQRENQEFQRELAELNHERAKEIEAFRAQVN… |
| A0A3N2KP69 | 52-448 | EQKLKISEAEHQRRISEMRIQNEARRKDAESLYFRACTDANMRTFLRDCWPLRNPFDSPLAIEPIYQETSQMLEGCKLKTIISPNKM… |
| A0A1Y1Q370 | 43-513 | None |
| A0A1Z4HAH5 | 28-510 | None |
| A0A0P0FK79 | 13-388 | None |
| A0A2N9YBW2 | 33-547 | None |
| A0A350Y7H3 | 69-592 | None |
| A8YLJ6 | 5-550 | None |
| K9VVD6 | 62-588 | None |
| A0A3R6KSE8 | 25-400 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.