DPCstruct | MC19878
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 177 ± 28 aa |
| Standard deviation of domain lengths | 27.69 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 16.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06097 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E6U7E8 | 185-378 | LKNLDIPSTMSLMQIYQTKLQPYEKAAAEAAAQGLPAPELNLTEAENTQVKADLQKLLAAGPQFALENLSFNTANGESKANLVIDLT… |
| A0A0A7A138 | 26-187 | LAAHPELANDEVALQEVNAALFKEYLPLLQQSEPTIKQPVRWKNALGELNANLDISIADPAKSSSSTNKDIKSLNFDVKLPLNVVTE… |
| A0A7Y2QFI8 | 10-192 | None |
| A0A0A2WJ87 | 702-889 | None |
| A0A090SSQ9 | 4-168 | None |
| A0A6M4MHG9 | 1-142 | None |
| A0A3T0L0B1 | 233-392 | None |
| A0A4Y4D1Y3 | 231-418 | None |
| P44131 | 6-149 | None |
| A0A0N8RTA4 | 3-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.