DPCstruct | MC19876
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 85 ± 4 aa |
| Standard deviation of domain lengths | 4.07 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 61.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q32F82 | 1-84 | MDIGGDSQVWTTAQFISWLESQGAFNHPYWMCKGSWAYANNKVITDTGCGNICLAGAVVEVTGTRGAMTIRVTTPGTSSGGGIT |
| A0A0A6ZTN2 | 1-79 | MDIGGDSQVWTTAQFISWLESQGAFNHPYWMCKGSWAYANNKVITDTGCGNICLAGAVVEVTGTRGAMTIRVTTPGTSS |
| A0A6L9CAE5 | 90-179 | None |
| T0PBW9 | 108-198 | None |
| A0A1R0Y936 | 699-782 | None |
| A0A2X3K697 | 1-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.