DPCstruct | MC19874
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 457 ± 57 aa |
| Standard deviation of domain lengths | 56.91 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E0GZX3 | 511-882 | TPTGLLAQMVDSGANILGISATASSPTVIHNFDHQYLSLRLGTRYRSLSDDQRKQLGAYYTSRRRYEEAGIRIHCQYIRAQTDNVNA… |
| A0A449I732 | 106-596 | DYSVYSQGVQLYQEEIDERDNQHRVRLSCREIATTPEKILIDLVNTDGTSIVLCSATASSWSVVSNCDIKYLKQTLGEKVHVLSKEE… |
| A0A5C1Q8Z3 | 33-477 | None |
| A0A1X2ZS85 | 2-394 | None |
| A0A2H1XMB8 | 420-815 | None |
| A0A8B4PE37 | 472-893 | None |
| A0A8B4FQJ6 | 2-540 | None |
| A0A0R1K5J1 | 327-819 | None |
| A0A376KZV5 | 90-639 | None |
| A0A655Z988 | 8-376 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.