DPCstruct | MC19873
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 230 ± 22 aa |
| Standard deviation of domain lengths | 22.21 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A415GCF0 | 39-249 | SIYTGNYNIYQIAKKVSLPSASTTKLNSVITNCCNDNPVIKWLHNYAKDKKYNFSDVNITSKGMNGNPAAYDHSTKILSFLTSNAIN… |
| A0A2R3MT32 | 3-223 | DNNDSGIYNGGGKWGDIPALPAKFNKLIFKNKNLNGAALQSLDRAFDEMLEVCSSAIYNYLINNGYRFTSVSIDPSLLGNAGYNFSN… |
| A0A3R6RZN4 | 87-330 | None |
| A0A1I6NUG2 | 255-478 | None |
| A0A3A9BHT3 | 146-402 | None |
| A0A6G9APH0 | 10-205 | None |
| A0A3L7Z8M2 | 67-310 | None |
| A0A1I2ZCH8 | 278-531 | None |
| A0A7W6HYG5 | 22-252 | None |
| A0A412VZY2 | 189-409 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.