DPCstruct | MC1987
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 105 ± 5 aa |
| Standard deviation of domain lengths | 4.72 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 33.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A132GPT7 | 52-157 | LYDYDNIVFKHISSKSELGCIIKRKDHKEKLAECSGKKVLAYHILWRLRNLLSDEQREDWINDIAAECGYKVDTISKKYKDETNMKP… |
| A0A3N2KE29 | 1-112 | MIHKLCNQEQFENISPGDMYSILNLHDCPRRLKIRDGEKNRVYYFIFFFGEMIDSAHRSHWRKSMCHHFCMSYKTYNSKYTELKTHP… |
| R6KPE1 | 135-242 | None |
| U2IM37 | 32-137 | None |
| R6AAQ6 | 106-213 | None |
| A0A2T4T721 | 192-288 | None |
| Q9KHQ4 | 680-775 | None |
| A0A7X7R1W5 | 221-326 | None |
| A0A1H7PKY9 | 7-108 | None |
| A0A3N2MQY0 | 259-363 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.