DPCstruct | MC19868
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 66 ± 8 aa |
| Standard deviation of domain lengths | 8.05 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 51.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B3ERV1 | 4-70 | EFYDTAMRKKIYTSLEELQRDLDEWLYYYNNERSHSGKYCYGKTPMQTFKDSKHLALEKNNELLYLS |
| A0A8B2TQ86 | 36-102 | GFIERLHRTLLDEHFRIKGRTTWYESVEQMQTDLDSYLDHYNTQRPHQGRMMEGQTPYSMFKKGLKL |
| A0A1H3JYB3 | 56-151 | None |
| A0A1B9M6A9 | 122-188 | None |
| A0A0P1HXL3 | 202-261 | None |
| A0A2M7ZZC6 | 3-64 | None |
| A0A855FRR9 | 1-71 | None |
| A0A1H6XMV3 | 20-91 | None |
| A0A1Y2S944 | 21-80 | None |
| A0A378MUV1 | 1-57 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.