DPCstruct | MC19864
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 172 ± 25 aa |
| Standard deviation of domain lengths | 25.00 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 68.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N1WK33 | 1-146 | MKRKKLNSQREEIGSKIEFNRKEITFLEFQEKINSKDKILKKILKNRDSKLIDSLDFVTGIDESSIVEIQRNGITTYTARVYTKTDS… |
| A0A369PW38 | 8-184 | TKGKAISCFLLLFLMLTNGCKKELLVPNNFKDTSADKIRSISYSQFINSINLNSTGSLKAPLLGQKTKLMSTQVLDENIDLEMDSVK… |
| A0A7U0DML6 | 1-178 | None |
| A0A5C6XPR5 | 19-229 | None |
| A0A362X0D3 | 7-173 | None |
| A0A2U2X8L6 | 4-166 | None |
| A0A4R6QEF2 | 8-197 | None |
| A0A0Q0X3T0 | 12-157 | None |
| A0A3D9AKJ3 | 11-187 | None |
| A0A162Z574 | 29-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.