DPCstruct | MC19862
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 285 ± 17 aa |
| Standard deviation of domain lengths | 16.83 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 78.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11067 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E8VMZ9 | 151-442 | KWFVISAAQWLAVAFYVGLVSVTLTLLVFTDLAFGWSSTISLSTDRVSGLAQVLATPWAAFAPGAVPSMELVEQSRFVRLADPPPDS… |
| A2SFR3 | 415-691 | HGARIATVLHAAAAAFAIGALAALYLRGIAFEYRAGWDSTFLTAQHVQQWLGLVLGPASALSGLALPDAAQLASLRFSVGPGENAAR… |
| A0A7X8V005 | 1-252 | None |
| A0A7C5FCS4 | 28-303 | None |
| A0A167INN1 | 174-456 | None |
| A0A1A8XNH7 | 250-539 | None |
| A0A432RS16 | 133-404 | None |
| A0A1Y5HF96 | 78-355 | None |
| A0A520RDU8 | 208-528 | None |
| A0A7C6VNW3 | 1-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.