DPCstruct | MC1986
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 169 ± 27 aa |
| Standard deviation of domain lengths | 26.88 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A370GPR9 | 164-345 | RSAAAPGGDTAVGIDISCPQCGYEDLVQSVPAICAAGTSTVSGTDYYSGVGIASTGFVPVVGSATVHHTRSTVLATELASEPYQRSA… |
| A0A5P9XQU9 | 2-156 | ALTCPGCGTEDIRKVSLIYENGVQKTRSKTLFGGGLLGLLGPMLGLGAAVTRGTNKTLTAERLGPPQKMRPVLSAVIVFLGMLFFAF… |
| E4NJC1 | 5-216 | None |
| A0A2V9D6U2 | 35-191 | None |
| A0A522QIB5 | 1-130 | None |
| A0A223DR06 | 3-210 | None |
| A0A7L9Q399 | 23-175 | None |
| A0A0M8SM08 | 22-242 | None |
| A0A350XKF7 | 149-293 | None |
| A0A2N0ZNS5 | 2-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.