DPCstruct | MC19858
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 143 ± 13 aa |
| Standard deviation of domain lengths | 12.71 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07355 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V0WW54 | 17-163 | YEQLARSYRIRERQRNITWTPFEAKLIDSKIALISVCGAYLKSGKPFTKEPQDSNYSYRAIDINFDRDDLEFFALDWETSELEKDIN… |
| A0A2E8NH63 | 40-192 | EGKAKDAMAQYPWFTTQGEPFTKLSKPLSEARVGLVTTGGYSIEGEQEPMRAYPTFGDEVPQVRRIPMDVDRSRLRIDHPGYDHKYA… |
| A0A2E8J361 | 1-115 | None |
| A0A1S1BQD0 | 188-343 | None |
| A0A7W1TPE5 | 18-171 | None |
| A0A7C1ESE8 | 24-166 | None |
| A0A5N9A9K4 | 91-243 | None |
| A0A7X4BZV0 | 60-209 | None |
| A0A4R2JAT4 | 445-580 | None |
| A0A2G4J4E3 | 47-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.