DPCstruct | MC19857
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 61 ± 5 aa |
| Standard deviation of domain lengths | 5.48 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 60.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00079 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Y9S9G2 | 21-76 | EQLSAANTRFALDLFRTLNESDPAGNIFISPFSISSALAMVFLGARGNTAAQMSKV |
| A0A674MVS2 | 2-59 | KYLDANTSFSLALFRKLSDNDTTANIFYSPFSISSALAMVLLGARGNTAAQMSEVHHS |
| D3ZN36 | 2-58 | None |
| A0A2I4CZY6 | 26-81 | None |
| A0A671Z3A7 | 5-68 | None |
| A0A3B3U0T6 | 5-61 | None |
| A0A7J5XIZ2 | 9-76 | None |
| A0A668SQJ2 | 7-61 | None |
| G3VEM4 | 1-65 | None |
| A0A3Q0T197 | 14-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.