DPCstruct | MC19855
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 67 ± 9 aa |
| Standard deviation of domain lengths | 9.43 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 92.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 41.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D0J1H6 | 1-56 | MKHLTLLGSTGSIGCSTLDVVRHNPDSYTVTALVAGKNVQRMVEQCMEFTPRFAVM |
| J9YV02 | 1-67 | MKKKIAILGSTGSIGENTLKIIAKDKKNFTVELLSTNKNIIKIYKQAKRFQVKNLIIHNKQSFLNNK |
| F2I0Z8 | 4-68 | None |
| A0A356TKB1 | 1-56 | None |
| O87046 | 1-92 | None |
| A0A1W4ULF3 | 1-60 | None |
| A0A6G3ATU5 | 1-67 | None |
| A0A0D2LS03 | 5-60 | None |
| A0A6I9QMQ7 | 75-140 | None |
| C6TNW1 | 78-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.