DPCstruct | MC19853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 127 ± 23 aa |
| Standard deviation of domain lengths | 23.45 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A826R7A7 | 60-169 | NRANADDLRQALFSLPALKYLMPHGKVETKMISWPLVNLDKARAFIFEKKAGAAVFMTRRAVPNDWEKVCMRVMLDAAQDAGVMFEP… |
| A0A7C2BAW6 | 4-119 | PCKASVPTGQRVESHAAWARAEADANVLRESGVARDGYIAVKAWPAATNPRGKAASAMEHYWITVLLERPVHGELSLIALRVMRDLC… |
| A0A1E4W895 | 2-98 | None |
| A0A2P6JJR5 | 1-156 | None |
| A0A494G976 | 397-547 | None |
| A0A1H5KF59 | 666-810 | None |
| A0A4Z0IR59 | 526-670 | None |
| A0A810ZJ17 | 2-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.