DPCstruct | MC19852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 429 ± 88 aa |
| Standard deviation of domain lengths | 88.16 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.95 |
| Pfam Score | 57.68 |
| Assigned Pfam label(s) | PF14496- CL0022- CL0613 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C8XB97 | 5-283 | FKYLDVLAATASPEGLQRLRELRAHPRSTRFIQLLDRLGETADRTLAPDNLASRAWAVIDAAAQSPALRDEFFSLAQRPDTCGDQVI… |
| A0A7C1WV11 | 27-551 | WLTLERVAIPELPPLPDFYATITQIELNNVVLDSAAADAFLANFPNVTRLNVQGSFTELPGVLPQLQYLEHLSLENMPWPIAQPVMD… |
| A0A3M4NJ77 | 20-336 | None |
| A0A3M5BUJ2 | 127-676 | None |
| A0A089YT92 | 588-1092 | None |
| A0A7T2JNM3 | 227-692 | None |
| A0A5B7UCT6 | 118-445 | None |
| A0A1B5F8Z0 | 442-951 | None |
| A0A328ZWG9 | 341-651 | None |
| A0A068Z9B5 | 74-520 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.