DPCstruct | MC1985
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 184 ± 26 aa |
| Standard deviation of domain lengths | 26.49 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0208 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A840KG33 | 1-134 | MYFVKNLGIPNGKTQVPAMLWFADKENLSVFALASDKRPAEKSPLYYAPFFNVYEDGAVCMGTVNVNIKNSASVEEFTTAWENYFFN… |
| A0A543Q2D9 | 1-168 | MLDNRTLAFNVSTLVFWSEPQVRTTYFDCPEPMGKRSGPVPHPGLVFVWQDHGLSVFAVKGRKRPSLNTPLFKAPYMNVYAGGSICM… |
| A0A431HND3 | 1-161 | None |
| A0A837UUS8 | 1-155 | None |
| A0A7C3NFY2 | 101-279 | None |
| A0A3D1P8F3 | 3-147 | None |
| A0A832AWE2 | 200-379 | None |
| A0A7V3M255 | 2-177 | None |
| A0A432DJA7 | 39-240 | None |
| A0A1V5ZNB1 | 39-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.