DPCstruct | MC19849
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 163 ± 23 aa |
| Standard deviation of domain lengths | 22.93 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 18.33 |
| Pfam Score | 85.71 |
| Assigned Pfam label(s) | PF10112- CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K0F4W0 | 2-105 | IFRLQHNIQKNAKLKAIDLRHDTLKAAKALFKELVKDPKRLPEASQFLYTHLPNIVDLTDNYVEINGHEVKTKEVYGKLEESAQIID… |
| A0A5Q2N7H2 | 30-214 | IAFELGVLLSLLSGALLYGGTLYALRVPARMALQAKNANPYGLEPAYVKQTLREGQQKLRQIGRLRRKIKGWFIRRKVNHIHRLGTE… |
| A0A3N4H6J1 | 39-213 | None |
| A0A2V3PRP7 | 552-684 | None |
| R2SST6 | 16-176 | None |
| V7ZTI6 | 2-125 | None |
| A0A7V2T162 | 136-285 | None |
| R5IZ11 | 48-232 | None |
| A0A7X8D825 | 41-225 | None |
| A0A847NAJ0 | 115-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.