DPCstruct | MC19848
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 306 ± 45 aa |
| Standard deviation of domain lengths | 44.82 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 17.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D2PEB4 | 16-343 | VSALSLLFANTTNSYKYIFFLSLLDILVRRKFDASLPISFREITIEMLANAWYPNSYFNLSFGVQDQIANKLIFLNITISDTSFQDA… |
| A0A5Q2N705 | 5-321 | EKCINSFLSNVSSKMSALYLPVMFLSLIELLEDHYKFDVVYGEHIQVTNTRVKISYPLISSYFLSYLLRIRKEIPSIKMAPTKNRTH… |
| C6BT14 | 100-453 | None |
| A0A1G0ZDM9 | 106-445 | None |
| A0A0F9U7G0 | 19-251 | None |
| A0A6N7C2X5 | 10-336 | None |
| A0A6M1SMI4 | 10-280 | None |
| A0A0P7WX31 | 6-423 | None |
| A0A842MYY8 | 14-290 | None |
| A0A1Z4JSI5 | 1-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.