DPCstruct | MC19846
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 372 ± 52 aa |
| Standard deviation of domain lengths | 52.31 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 27.76 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | PF12500- CL0533 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W8V3B0 | 105-448 | LEVKVDAAALPAATLFGFAERRNPKRAFLFVSKVLGRLVPTRPSIMAASFESLVSEIPADLPGPVLVIGVAEAAVGLGAGVHRAYSA… |
| A0A5Q2N1R9 | 3-400 | KRLMEALDGEQAYVTPKGTFVLPSSHLFIGFAETATALGQAVFSCFEQNALYWHTTREKINELPDLFDFEEEHCHAPEHRLYAVKAS… |
| J7ISK8 | 33-462 | None |
| A0A1G8UIL2 | 20-455 | None |
| A0A1Q9HX51 | 7-353 | None |
| A0A521G388 | 14-284 | None |
| A0A8A9EH45 | 1-276 | None |
| A0A286CF37 | 44-463 | None |
| A0A7J0CME7 | 27-431 | None |
| A0A660NDS0 | 334-714 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.