DPCstruct | MC19840
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 166 ± 35 aa |
| Standard deviation of domain lengths | 34.85 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 69.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.04 |
| Pfam Score | 84.29 |
| Assigned Pfam label(s) | CL0148- CL0074 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7VIB2 | 1-108 | MGQTQTTPLSIMVDHSKEVKGRASNLSAEVRKGWWQTFCSREWPTFNVRWPPEGTFDLPTIRRVRDVVSQPMEVHPDQLSYIVTWQD… |
| A0A6P4VFR5 | 1-166 | MGQTQSTPLSLLLANFRDVRARGHNLSLDIRKRKLITYCRSEWPTFGVNWPTEGTFCLPVVLKVKSKIFLPGKEGHSDQIPYILVWQ… |
| A0A811YRX8 | 2-169 | None |
| W5PYQ2 | 1-126 | None |
| A0A7J8AVC2 | 1-227 | None |
| A0A7J8C2D6 | 1-129 | None |
| A0A5F5XT86 | 1-189 | None |
| Q61540 | 2-197 | None |
| A0A674K690 | 8-223 | None |
| A0A3Q7WL39 | 1-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.