DPCstruct | MC1984
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 58 ± 5 aa |
| Standard deviation of domain lengths | 5.39 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 47.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A543Q1N8 | 13-72 | KRHPQIEPLLTTIAQKYLRVETLQTQHSDSADFHNVSVWELRAALEAAFQAGTQLGASVT |
| A0A5M4D5R1 | 2-53 | TTARDNAINRIAREALGLETLETRRMDSLDFHDLAVWTIKDALERAYEAGRK |
| A0A7Y4IH86 | 16-81 | None |
| A0A0G3BMJ7 | 2-60 | None |
| A0A430GY37 | 2-53 | None |
| A0A285TXT8 | 118-184 | None |
| A0A3R7HUP8 | 6-71 | None |
| A0A7T9DF21 | 6-63 | None |
| A0A1E4IH98 | 1-58 | None |
| A0A3S4M9A8 | 34-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.