DPCstruct | MC19839
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 100 ± 7 aa |
| Standard deviation of domain lengths | 7.44 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 49.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0642 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D4H1H3 | 51-151 | PKMLKFCASSPRSMEIILNSYDRVVSCDSWIGSVPTEMWHEYQVFYDSALFLVNQPRPLQHLARCAIRRQLGIRCHKGIFQLKLPSA… |
| A0A6P4V0G3 | 1-99 | MLKHCANFPRALEVLLNAYPYVPSCDTWVEAVLPELWQEHEAFYTSALSMVNQPRRLQHLARLAVRAQLGGRCRQAVASLPLPPVLR… |
| L8Y8C7 | 127-227 | None |
| A0A1A6HPW3 | 1-113 | None |
| A0A3L8RWT8 | 16-96 | None |
| A0A6P6IDT1 | 49-148 | None |
| V8NE17 | 107-208 | None |
| A0A212D9G1 | 33-133 | None |
| A0A401PPY1 | 216-319 | None |
| G7NIX1 | 275-375 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.