DPCstruct | MC19838
Metacluster Properties and Pfam Annotations
| Number of structural domains | 83 |
|---|---|
| Mean domain length (aa) | 92 ± 13 aa |
| Standard deviation of domain lengths | 12.78 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 73.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.85 |
| Pfam Score | 98.28 |
| Assigned Pfam label(s) | CL0221- PF00658- PF07889 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820CKV4 | 6-90 | QIVVAGQEPLTAAALANATPREQKQMLGERLFPLIQRMQPDLAGTITGMLVDLHNNTELLHLLESRESLKAKVDEAFSVLQARLA |
| A0A6P4UEU9 | 552-646 | IQPLQAPQPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAV… |
| A0A5J4ULC4 | 288-367 | None |
| A0A2Z6M9R8 | 341-435 | None |
| A0A5N4CU79 | 755-843 | None |
| A0A565BRU5 | 67-174 | None |
| A0A813PEB3 | 122-214 | None |
| A0A2G3B1Z1 | 11-86 | None |
| A0A0B7NKR3 | 411-534 | None |
| A0A396HHE9 | 1-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.