DPCstruct | MC19834
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 223 ± 16 aa |
| Standard deviation of domain lengths | 16.40 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W3WLJ7 | 2-201 | TGEKYLRSLGKRWVSVGMHYQTGPSGAKATYRYSTSAEASLAVGMSKSGKLGTFSGNGSLKRSTSASIGFGTQGPKTGIRHYTMYKY… |
| A0A1M5X7Y0 | 177-397 | TPYIDVCKWHSVVIARQIAYTTVGESHAYWDAAGYADYSSKLSSTFDLGYSVDGKNWKVGGSVSLGSSIAATVGFTWRGPYFAKQLR… |
| A0A499V2I2 | 138-345 | None |
| A0A560WYM6 | 64-316 | None |
| A0A515XY15 | 378-590 | None |
| A0A7W7MIV7 | 65-275 | None |
| A0A101TGE9 | 511-748 | None |
| A0A397MW15 | 311-536 | None |
| A0A497GJW9 | 174-424 | None |
| A0A6C6XXM9 | 177-395 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.