DPCstruct | MC19828
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 111 ± 9 aa |
| Standard deviation of domain lengths | 9.24 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 38.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L7LBC0 | 116-232 | LVATAEANNLTAVAEAKEVYTTLMEEICGGSKPYLQSLLLEAEHGRVRDKALHAFHAKRKMGGDEFSLSYCTQLTQDLEDQFNQFKS… |
| A0A0T6BCF4 | 1-115 | MYVKLMDEVCGGTRPYLNTNTMESEHRRVKDKALHQFQSKRKMGGEEFSEKYKDQLEKDLEETKHLSSLNLTTKAKISSKRQERLQC… |
| A0A4W3GH24 | 1-91 | None |
| A0A670ZKF3 | 30-141 | None |
| A0A2B4R858 | 313-426 | None |
| A0A803WAI9 | 284-389 | None |
| A0A0V1K1R3 | 934-1035 | None |
| A0A5F8HDX4 | 495-615 | None |
| I4DNP0 | 116-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.