DPCstruct | MC19826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 342 ± 49 aa |
| Standard deviation of domain lengths | 49.45 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 27.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7WJL0 | 3-292 | TKKSLELTHQEMHELKAKYEKSNQDASDTQLRLAQFQEEVGDLQRKLELAHHESKTIQERLEETQIAVDKEKHSKEEALLRNAQISQ… |
| A0A0T6BBL8 | 69-348 | QEEQLSDVQQNSTTEVKAVRKNLENSESELEKTEDECSKLRLSVDAEHQTNTSLKEVITKLEKDLGEERHHSLNVQKTLSRVTSEKN… |
| U3I7F4 | 243-655 | None |
| A0A3B3QR04 | 50-324 | None |
| A0A4W2G7E5 | 676-1027 | None |
| A0A2J7RL00 | 107-515 | None |
| A0A7R8W6X3 | 199-580 | None |
| A0A3M7RES9 | 88-388 | None |
| L7M2C2 | 342-730 | None |
| A0A6J2EZ25 | 207-561 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.