DPCstruct | MC19825
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 167 ± 18 aa |
| Standard deviation of domain lengths | 17.69 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 70.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.71 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04180 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A437DNK2 | 2-140 | VPVVVEPPEEKWDCETIISTYSNLYNRPKVIEEPAKPKSIRVSSKTGIPLDVLPNRGLTAKQAERMTRINDSDLPRVSTQPRGREES… |
| A0A0T6B4G1 | 20-186 | DIKDKICLQECSDSESSEELINVEIPEKETWDCESILSTYSNIYNHPKLIEEPSKSKIRINMKTGMPMNVLNSNKLTVKAVESLNLQ… |
| A0A4Y7M5Q4 | 599-771 | None |
| A0A7R9APU8 | 205-395 | None |
| A0A7R9ZL27 | 3-181 | None |
| A0A7J8KBI5 | 41-187 | None |
| A0A3Q2G585 | 249-387 | None |
| A0A0P4X0E6 | 155-346 | None |
| F0ZFG8 | 341-485 | None |
| C3ZI23 | 142-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.