DPCstruct | MC19820
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 132 ± 24 aa |
| Standard deviation of domain lengths | 23.90 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 16.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W5A9L3 | 2-133 | KTTTLAEAFAFFGTYPDNPRWSWSAVSPDLKTVAVTIWENEVGVDGSIDVFGSPDLADWTSKPGNRERIRNLKIARENCGGLFHVIW… |
| A0A537AE91 | 69-191 | LPAHGLVTRTKAFEMHGVSPRNRTWSRGGVRTDGAVVLTLRVDEVQPAAVGKACLLWGPNVAGSRPWSDSPGGQERLEHCRMALERG… |
| A0A521VLN4 | 49-179 | None |
| A0A6P2E774 | 13-168 | None |
| A0A3R9XFG2 | 1-139 | None |
| A0A3N9DJJ6 | 28-223 | None |
| A0A128F8H6 | 7-137 | None |
| A0A2W4RN67 | 2-134 | None |
| A0A7I8CQF1 | 1-187 | None |
| A0A2W7C2C4 | 16-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.