DPCstruct | MC1982
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 84 ± 9 aa |
| Standard deviation of domain lengths | 8.71 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 37.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J2XA51 | 101-188 | PSLFWSLANAIYWIFWLNLAVGLFNALPMIPLDGGYILQDVFEALLDRFRIESRRKEKIRKTVMVTISLFILFLVLYPLLLKYTYPLF |
| A0A257A388 | 26-111 | IFWIIYNIIYWVFWLNFAIGTFNALPIMPLDGGYIFKDGVSFTIYKINRRIKDNKLEKISSTITTIVSVIIFLSLLSIIVVPRLRS |
| A0A7J4EHF4 | 150-236 | None |
| A0A7J9TQT8 | 7-89 | None |
| A0A849R805 | 149-225 | None |
| A0A1V4UDY1 | 2-74 | None |
| A0A842WLR9 | 79-157 | None |
| A0A7C5CWR2 | 37-144 | None |
| A0A7K3ZL46 | 101-180 | None |
| A0A7J3WUF8 | 2-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.