DPCstruct | MC19819
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 228 ± 21 aa |
| Standard deviation of domain lengths | 21.05 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A537A935 | 1-236 | MQPIRVRGVIANPGSAKQTMLDRIREWTALEPWTGASINTVTGGADIQDLPLPLLLVVAVVIAAAALVWRLRQHLRAMAPSLAVAVA… |
| A0A846SQC7 | 51-284 | KPLLVRQLELRTPPLTTAQLLRQIAQDWTTFESWSQRSINFTAGAPLDALFPPVVTVALWIGFSALLYALLTLPNCAAQGVVPYAAL… |
| G4E1R8 | 162-390 | None |
| A0A2E7C031 | 145-356 | None |
| A0A2D8IQJ1 | 141-328 | None |
| F9U9A5 | 1-272 | None |
| A0A2D4TDC8 | 184-403 | None |
| A0A1F7BRE6 | 171-402 | None |
| A0A7Y5VT04 | 177-408 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.