DPCstruct | MC19811
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 83 ± 9 aa |
| Standard deviation of domain lengths | 9.25 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02810 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A142BAG8 | 25-108 | TAKLGTEKNPASVVVQTEERFREIQTIFSENGWIVDIELNEEKEENLVDLEVLQNTPKTTVVDKTPGRNDPCICGSGKKYKKCC |
| A0A367ZQ31 | 1-85 | MPKKGHKKNPIVINVHSATEAQHYAAICAEHGWHFIIGMNPHEPVDLRQLEEARHPPEPLTADARPDRNAPCPCGSGKKFKKCCG |
| A0A2N5GQS6 | 1-70 | None |
| B7VP16 | 74-170 | None |
| A0A7U1EQA6 | 228-307 | None |
| A0A2K8UBZ8 | 1-84 | None |
| A0A0M0XCT2 | 1-76 | None |
| A0A2D7EZD1 | 25-124 | None |
| A0A1F3CAD6 | 1-64 | None |
| A0A7V4Y3F3 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.