DPCstruct | MC1981
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 65 ± 5 aa |
| Standard deviation of domain lengths | 4.67 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 78.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E8FJX7 | 35-97 | TINVPTKTLGGSQFWGDVRFFQGWRIQQNVFTGHFRLLDPADVRRGWGTRKACDRRLDGLLKS |
| A0A6M1U832 | 1-68 | MLYPNLPIKTAGGKVFWDTLDRRNGWKLQQNMFTGHFRILDPDDVRQAWGTDESEMWRTFRNFAGSRS |
| A0A380ELV4 | 35-96 | None |
| R7EW87 | 67-142 | None |
| A0A1Z3CLB8 | 1-60 | None |
| W7Z4B3 | 2-59 | None |
| A0A2E9VIV2 | 694-764 | None |
| A0A374AMI9 | 31-95 | None |
| A0A0H2MK13 | 28-89 | None |
| A0A1G8MA33 | 31-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.