DPCstruct | MC19809
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 88 ± 8 aa |
| Standard deviation of domain lengths | 7.57 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 46.44 |
| Pfam Score | 87.27 |
| Assigned Pfam label(s) | PF06415- CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A844WAX5 | 3-75 | VTKKPMVLVILDGYGYREDQQDNAIYSAKTPVMDALWAKRPHTLIDASGLEVGLPDRQMGDSEVGHVNLGAGR |
| A0A367ZKK7 | 4-90 | TNNVLLVILSGFGLSDHSTGNAVRLANPEFLGKLFLERPLARLAAAGPAVGLRPGDPGNSEAGHLTIGAGRVVEQDLTRISRAIDDS |
| W1EI20 | 3-80 | None |
| A0A2E0U0L1 | 2-89 | None |
| A0A4Y7LDF0 | 2-97 | None |
| A0A7J0G404 | 2-85 | None |
| A0A7V0KIQ0 | 153-232 | None |
| A0A0M3C4K9 | 38-122 | None |
| A0A0G1UD43 | 12-93 | None |
| A0A540M9I2 | 1-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.