DPCstruct | MC19808
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 152 ± 13 aa |
| Standard deviation of domain lengths | 12.68 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.30 |
| Pfam Score | 76.39 |
| Assigned Pfam label(s) | PF13363- CL0369- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A124GTI6 | 77-230 | RNEAYNYWVMELPVSSPIGNYSSPSKSLVIVKAGYLIRTADLINNQLRLTGDVNATTVIEVISTPATTLKGTIFNGEVLHTSKTPNG… |
| A0A1L7T735 | 12-165 | AVVVGRRSAYKFWAPTFDNNPHAWENSIVLVSGFSLVRSVSIKGNTININGDWDEETTIEIWAPNKIRKVAFNRENLHVTKSKYGSF… |
| A0A0A2LPK9 | 152-306 | None |
| A0A4S8LFU8 | 4-171 | None |
| A0A5M3MPQ7 | 77-256 | None |
| A0A0F0I818 | 250-404 | None |
| A0A7Y7M027 | 178-323 | None |
| A0A1V6YEG2 | 142-266 | None |
| A0A2H3CXL3 | 19-178 | None |
| K9GCL7 | 485-618 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.