DPCstruct | MC19807
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 216 ± 38 aa |
| Standard deviation of domain lengths | 37.65 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812SFB5 | 1-125 | VFERSQCLAFCRELKDLREQGKPVVVNKKLSVLPNAWWGIKGGYEVELVLIYLDQCRDFEAQLPTETREQIAKGDQGAFANFPIYPV… |
| A0A081NG62 | 351-584 | SSMPNGWKPDCQLIDGGFLDYLGIMPLLARKSERIIAFINTGIPIRSKVLVSGEDLVGMEKALPALFGIQPDESLEEDAYLLLKSSS… |
| A0A812RE12 | 27-228 | None |
| A0A812RE24 | 931-1132 | None |
| R1E1P8 | 452-665 | None |
| Q5LKP4 | 517-734 | None |
| A0A7S2JQD0 | 222-433 | None |
| A0A6P0TE34 | 96-274 | None |
| A0A383WMJ4 | 129-336 | None |
| A0A1E7I713 | 9-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.