DPCstruct | MC19804
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 112 ± 7 aa |
| Standard deviation of domain lengths | 7.27 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 43.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A081NFA4 | 1-120 | MAINNDDVKLFESQRLSDEEDGGGRATGNVVIDGNVNNLFQDISRIDRTIGDVALRKAYIGISTDNNDAYLGSHIILTDAPDDDNVS… |
| A0A1D2XDY5 | 1-93 | MAINNTDVKLFESQRLTDEDDGGGRVTGTEVIDGNINNLYLDISRIDRTVGDVALRKAFVGVSTDNNDAYLGSHIILTEAPKDENVS… |
| A0A4R0F9N0 | 1-114 | None |
| A0A2G6FTF8 | 1-115 | None |
| A0A4Y9JJD6 | 1-113 | None |
| A0A7I8HVK7 | 1-114 | None |
| A0A1F4E6V8 | 1-117 | None |
| A0A2T6EB16 | 1-110 | None |
| A0A841S1J1 | 1-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.