DPCstruct | MC19802
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 127 ± 10 aa |
| Standard deviation of domain lengths | 9.73 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V3PVV7 | 114-234 | TNYINYLTMKKNLILIFSLFSIGWCNAQVGINTENPSGIFHIDPKADTQLNGSGDADDIIVTKDGYVGIGTSTPSTYLHIKTATAGT… |
| A0A1M4TKI5 | 2-114 | KKYLLLAGFAAMNTLSAQMGINTDNPQTAFHVDASKDNNTSGTPTIAQQDNDLAVTSAGGMGIGITTPNVKVELNSGTANTSGLKFT… |
| A0A380BHG1 | 1-139 | None |
| A0A7K1X6X1 | 1-120 | None |
| A0A086BJV1 | 1-127 | None |
| A0A511YBZ3 | 2-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.