DPCstruct | MC19800
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 574 ± 97 aa |
| Standard deviation of domain lengths | 97.12 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6ZNE5 | 22-636 | GEPPAWANFRSELGDTLPWFRAVQGGIYHKDGLAWGVLISRDSGERSYIDEEVVITRIGGSCSRNANGDLVHVKDQEKNDLMVKCLL… |
| A0A1V6R8U9 | 10-665 | RQAAERPVRTGRIAKTKKEQSIKVSLDQLEAVVNDQTLEPVYGTPPAWSEGRQQLCDAIPWFRCTQGAMYHNEGFCYGFLIDADGGT… |
| A0A507DUN6 | 2-585 | None |
| A0A218YSW9 | 130-737 | None |
| A0A3N4LN94 | 1-458 | None |
| A0A229XUX1 | 1-476 | None |
| A0A225X8X0 | 2-388 | None |
| A0A370PGQ5 | 357-969 | None |
| A0A0C2YEU9 | 509-1124 | None |
| A0A420Y5S2 | 138-695 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.