DPCstruct | MC1980
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 77 ± 6 aa |
| Standard deviation of domain lengths | 5.58 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 36.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18832 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A242CGE6 | 3-77 | RNGIRLKGHIGTFYIIKETEEYGRKIYLLESEIYGDDANHVVVDQECKILYSNEYNGFSDYEDALDSFLYHLKEK |
| I3U6Q7 | 5-72 | ISLTSNNIKVSGHIGTWYVYASRVYHGRRLFLVEHETYGDHAANLILDKTGNCVMEDVWNGWEDYEVY |
| A0A7X3MCU4 | 280-356 | None |
| A0A417K6M8 | 44-119 | None |
| A0A0Q7S835 | 4-76 | None |
| A0A3E2TYZ9 | 55-135 | None |
| A0A413PZM9 | 134-204 | None |
| R6LWP8 | 87-168 | None |
| A0A6N3CIB8 | 131-205 | None |
| A0A564WKC3 | 390-465 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.