DPCstruct | MC198
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 113 ± 12 aa |
| Standard deviation of domain lengths | 12.14 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 33.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0316 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C7FSZ3 | 433-524 | GMLARVRILAPFGRMALSNYLMQSLVFSLLFYAHGLGLWGIGRTEQVGIALLLCALQIVFSHWWLTRFQYGPLEWAWRALTYLSWPP… |
| A0A4Q3T834 | 24-148 | IKNAPWLRWLGGSLADIFNAAVTIFYIACISLLMLKPNWHARLAPLSYIGKMALTSYLTQSLFGVILFFHFGLGLFFITSPALNAVL… |
| Q3EJR9 | 65-182 | None |
| A0A3D1RFU9 | 207-318 | None |
| A0A7X2ZS42 | 101-210 | None |
| A0A1Z8N386 | 33-134 | None |
| A0A4Q2XNY8 | 194-294 | None |
| A0A5S9MHK6 | 5-129 | None |
| A0A6C0GFS6 | 91-198 | None |
| A0A0B8NAN2 | 4-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.