DPCstruct | MC19797
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 177 ± 21 aa |
| Standard deviation of domain lengths | 21.06 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 36.00 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | CL0028- CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y0G0P3 | 141-306 | GSLSCPSGMSCGCYTVSGLGANKQAYVNAGADRRFLASAMMETEKMDTNYAYGDNKTGDAFNAGATKQNWGMMRQCHSEWRGYSAND… |
| A0A1V6Q7G9 | 4-169 | VVSAADRGSYTSPGIGARKKAILDAGGNTRDMAIAMLETNTMTTDYTYGDGKTGDGTNFGVFKQNWYMLRNSASEFLGQTVAQVSNG… |
| A0A1L9SZB2 | 1-182 | None |
| I0YJ23 | 36-252 | None |
| A0A3A8MTV0 | 62-277 | None |
| A0A0G4LLM6 | 1089-1277 | None |
| A0A162RQN7 | 1-160 | None |
| A0A094I265 | 16-183 | None |
| A0A371AZX3 | 19-206 | None |
| A0A5N6G6C4 | 4-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.