DPCstruct | MC19796
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 155 ± 27 aa |
| Standard deviation of domain lengths | 26.90 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.81 |
| Pfam Score | 98.75 |
| Assigned Pfam label(s) | PF06682- PF03169 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4V7J5 | 5-109 | FSAYAQKVRLKDVATITLHRDEFTTARRSQAIPQLKCVGGSAKAHAQPRVVQCYNRGLDGHDVQWECKAELPKDVEFGRIRVSCEGY… |
| A0A6P7ICH7 | 10-159 | LLSVGHIESLNGDSVLLRDIQVLTLYRSRYTTARRSSPIPQLKCVGGSAGCQAFIPDVVQCVNKGWDGVDVQWECRTDMDNAYRFGH… |
| S7Q2B5 | 589-729 | None |
| A0A1V8SX31 | 9-143 | None |
| R9P7W4 | 21-151 | None |
| A0A2B7XDA4 | 22-198 | None |
| A0A7S3G7R1 | 90-255 | None |
| O13980 | 9-169 | None |
| A0A5J4YVK9 | 33-198 | None |
| A0A183XA74 | 7-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.