DPCstruct | MC19795
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 195 ± 14 aa |
| Standard deviation of domain lengths | 14.21 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 74.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00687 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V1KVC5 | 1-193 | MINSLLLDMFSATLPMLITTRGAKRRGVQALRKLKEAKLGIKTKVVKKERASSPITTTNSSIAAQYPARVELLPDLLDEPLDSVWKF… |
| A0A7M7LJM4 | 65-234 | IFPGVLSQVRHYAARKGTREKAKKKKVKVEVKKLTFEEKVRRSKKINIIKPDAMITNEHTKPVAVDDVFYMRYFRWKVYSFAEAIQN… |
| A0A212EI69 | 1-193 | None |
| A0A7R9E2Q9 | 18-219 | None |
| C1BSZ3 | 1-196 | None |
| A0A0N4T8U3 | 1-217 | None |
| A0A026WHF7 | 201-382 | None |
| A0A3N0ZAS6 | 1-184 | None |
| A0A183EP81 | 1-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.