DPCstruct | MC19794
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 69 ± 4 aa |
| Standard deviation of domain lengths | 3.53 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 73.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D7ZJ83 | 306-375 | VNVVTWRKIKDQPGTGKSEWDKRWWVRMHWRKQWYPSKNAHRLICIAPFVKGNPNMPLHIPKPTVNKVDR |
| A0A8B2VD90 | 1-68 | MRPMRQVHTTTDATGRRLTTRHVVRGHWTHQPYGPKRSLRRLQWVAPFIRGPEGSPFVGTDTVTVWRR |
| A0A0H5CHH1 | 81-148 | None |
| A0A5M9ZVT2 | 176-239 | None |
| A0A1C6R7I2 | 434-504 | None |
| A0A3D5W5M5 | 350-426 | None |
| A0A7D5VNI9 | 265-333 | None |
| A0A6V8KAW1 | 79-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.